SCOPe 2.04: Domain d3pj3a_: 3pj3 A:

Lineage for d3pj3a_ (3pj3 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)

8. Domain d3pj3a_: 3pj3 A: [183783]
   automated match to d1k2pa_
   complexed with 04l

Details for d3pj3a_

PDB Entry: 3pj3, 1.85 Å

PDB Description: Crystal structure of BTK kinase domain complexed with 2-Methyl-5-[(E)-(3-phenyl-acryloyl)amino]-N-(2-phenyl-3H-imidazo[4,5-b]pyridin-6-yl)-benzamide

PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d3pj3a_:

Sequence, based on SEQRES records:

>d3pj3a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmm
nlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceame
yleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlm
yskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytim
yscwhekaderptfkillsnildvmdees

Sequence, based on observed residues (ATOM records):

>d3pj3a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gygsweidpkdltflkelgtgvvkygkwrgqydvaikmidefieeakvmmnlsheklvql
ygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceameyleskqflhr
dlaarnclvndqgvvkvsdfpvrwsppevlmyskfssksdiwafgvlmweiyslgkmpye
rftnsetaehiaqglrlyrphlasekvytimyscwhekaderptfkillsnildvmdees

Timeline for d3pj3a_:

• d3pj3a_ first appeared in SCOPe 2.01
  
• d3pj3a_ appears in SCOPe 2.03
  
• d3pj3a_ appears in SCOPe 2.05
  
• d3pj3a_ appears in the current release, SCOPe 2.08