Lineage for d3pj1a_ (3pj1 A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043604Protein automated matches [190091] (8 species)
    not a true protein
  7. 1043667Species Human (Homo sapiens) [TaxId:9606] [188447] (254 PDB entries)
  8. 1043765Domain d3pj1a_: 3pj1 A: [183781]
    automated match to d1k2pa_
    complexed with lhl

Details for d3pj1a_

PDB Entry: 3pj1 (more details), 2 Å

PDB Description: Crystal structure of BTK kinase domain complexed with 3-(2,6-Dichloro-phenyl)-7-[4-(2-diethylamino-ethoxy)-phenylamino]-1-methyl-3,4-dihydro-1H-pyrimido[4,5-d]pyrimidin-2-one
PDB Compounds: (A:) Tyrosine-protein kinase BTK

SCOPe Domain Sequences for d3pj1a_:

Sequence, based on SEQRES records: (download)

>d3pj1a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gygsweidpkdltflkelgtgqfgvvkygkwrgqydvaikmikegsmsedefieeakvmm
nlsheklvqlygvctkqrpifiiteymangcllnylremrhrfqtqqllemckdvceame
yleskqflhrdlaarnclvndqgvvkvsdfglsryvlddeytssvgskfpvrwsppevlm
yskfssksdiwafgvlmweiyslgkmpyerftnsetaehiaqglrlyrphlasekvytim
yscwhekaderptfkillsnildvmdees

Sequence, based on observed residues (ATOM records): (download)

>d3pj1a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gygsweidpkdltflkelgtgvvkygkwrgqydvaikmisedefieeakvmmnlsheklv
qlygvctkqifiiteymangcllnylremrfqtqqllemckdvceameyleskqflhrdl
aarnclvndqgvvkvsdfglfpvrwsppevlmyskfssksdiwafgvlmweiyslgkmpy
erftnsetaehiaqglrlyrphlasekvytimyscwhekaderptfkillsnildvmdee
s

SCOPe Domain Coordinates for d3pj1a_:

Click to download the PDB-style file with coordinates for d3pj1a_.
(The format of our PDB-style files is described here.)

Timeline for d3pj1a_: