Lineage for d3pira_ (3pir A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595370Protein automated matches [190047] (24 species)
    not a true protein
  7. 1595654Species Mouse (Mus musculus) [TaxId:10090] [186896] (12 PDB entries)
  8. 1595668Domain d3pira_: 3pir A: [183776]
    automated match to d1x1ra1
    complexed with gnp, mg

Details for d3pira_

PDB Entry: 3pir (more details), 2.75 Å

PDB Description: Crystal structure of M-RasD41E in complex with GppNHp (type 1)
PDB Compounds: (A:) Ras-related protein M-Ras

SCOPe Domain Sequences for d3pira_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pira_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lptyklvvvgdggvgksaltiqffqkifvpeydptiedsylkhteidnqwaildvldtag
qeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdl
mhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq

SCOPe Domain Coordinates for d3pira_:

Click to download the PDB-style file with coordinates for d3pira_.
(The format of our PDB-style files is described here.)

Timeline for d3pira_: