SCOPe 2.07: Domain d3pina_: 3pin A:

Lineage for d3pina_ (3pin A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187694] (14 PDB entries)

8. Domain d3pina_: 3pin A: [183775]
   Other proteins in same PDB: d3pinb_
   automated match to d1erva_

Details for d3pina_

PDB Entry: 3pin, 2.7 Å

PDB Description: Crystal structure of Mxr1 from Saccharomyces cerevisiae in complex with Trx2

PDB Compounds: (A:) Thioredoxin-2

SCOPe Domain Sequences for d3pina_:

Sequence; same for both SEQRES and ATOM records:

>d3pina_ c.47.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvtqlksaseydsalasgdklvvvdffatwcgpskmiapmiekfaeqysdaafykldvde
vsdvaqkaevssmptlifykggkevtrvvganpaaikqaiasnv

Timeline for d3pina_:

• d3pina_ first appeared in SCOPe 2.01
  
• d3pina_ appears in SCOPe 2.06
  
• d3pina_ appears in the current release, SCOPe 2.08