Lineage for d3piac_ (3pia C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686276Species Cow (Bos taurus) [TaxId:9913] [46490] (12 PDB entries)
  8. 2686286Domain d3piac_: 3pia C: [183769]
    Other proteins in same PDB: d3piab_, d3piad_
    automated match to d1fsxa_
    complexed with cmo, hem

Details for d3piac_

PDB Entry: 3pia (more details), 2.1 Å

PDB Description: Site-specific Glycosylation of Hemoglobin Utilizing Oxime Ligation Chemistry as a Viable Alternative to PEGylation
PDB Compounds: (C:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3piac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3piac_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d3piac_:

Click to download the PDB-style file with coordinates for d3piac_.
(The format of our PDB-style files is described here.)

Timeline for d3piac_: