SCOPe 2.07: Domain d3pi9b_: 3pi9 B:

Lineage for d3pi9b_ (3pi9 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries)

8. Domain d3pi9b_: 3pi9 B: [183764]
   Other proteins in same PDB: d3pi9a_, d3pi9c_
   automated match to d1fsxb_
   complexed with cmo, hem

Details for d3pi9b_

PDB Entry: 3pi9, 2.9 Å

PDB Description: Site-specific Glycosylation of Hemoglobin Utilizing Oxime Ligation Chemistry as a Viable Alternative to PEGylation

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3pi9b_:

Sequence; same for both SEQRES and ATOM records:

>d3pi9b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

Timeline for d3pi9b_:

• d3pi9b_ first appeared in SCOPe 2.01
  
• d3pi9b_ appears in SCOPe 2.06
  
• d3pi9b_ appears in the current release, SCOPe 2.08