Lineage for d3pi8d_ (3pi8 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687041Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries)
  8. 2687059Domain d3pi8d_: 3pi8 D: [183762]
    Other proteins in same PDB: d3pi8a_, d3pi8c_
    automated match to d1fsxb_
    complexed with cmo, hem

Details for d3pi8d_

PDB Entry: 3pi8 (more details), 2.2 Å

PDB Description: Site-specific Glycosylation of Hemoglobin Utilizing Oxime Ligation Chemistry as a Viable Alternative to PEGylation
PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3pi8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pi8d_ a.1.1.2 (D:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOPe Domain Coordinates for d3pi8d_:

Click to download the PDB-style file with coordinates for d3pi8d_.
(The format of our PDB-style files is described here.)

Timeline for d3pi8d_: