Lineage for d3phna_ (3phn A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1399946Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1399947Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1399948Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1399949Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 1399963Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)
  8. 1399965Domain d3phna_: 3phn A: [183744]
    automated match to d1onca_
    complexed with act, so4

Details for d3phna_

PDB Entry: 3phn (more details), 1.46 Å

PDB Description: crystal structure of wild-type onconase with resolution 1.46 a
PDB Compounds: (A:) Protein P-30

SCOPe Domain Sequences for d3phna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3phna_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

SCOPe Domain Coordinates for d3phna_:

Click to download the PDB-style file with coordinates for d3phna_.
(The format of our PDB-style files is described here.)

Timeline for d3phna_: