SCOPe 2.01: Domain d3phna_: 3phn A:

Lineage for d3phna_ (3phn A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (5 species)

7. Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)

8. Domain d3phna_: 3phn A: [183744]
   automated match to d1onca_
   complexed with act, so4

Details for d3phna_

PDB Entry: 3phn, 1.46 Å

PDB Description: crystal structure of wild-type onconase with resolution 1.46 a

PDB Compounds: (A:) Protein P-30

SCOPe Domain Sequences for d3phna_:

Sequence; same for both SEQRES and ATOM records:

>d3phna_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

Timeline for d3phna_:

• d3phna_ is new in SCOPe 2.01-stable
  
• d3phna_ appears in SCOPe 2.02
  
• d3phna_ appears in the current release, SCOPe 2.08