SCOPe 2.07: Domain d3ph9b_: 3ph9 B:

Lineage for d3ph9b_ (3ph9 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d3ph9b_: 3ph9 B: [183739]
   automated match to d1sena_

Details for d3ph9b_

PDB Entry: 3ph9, 1.83 Å

PDB Description: Crystal structure of the human anterior gradient protein 3

PDB Compounds: (B:) Anterior gradient protein 3 homolog

SCOPe Domain Sequences for d3ph9b_:

Sequence; same for both SEQRES and ATOM records:

>d3ph9b_ c.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqtlsrgwgdditwvqtyeeglfyaqkskkplmvihhledcqysqalkkvfaqneeiqem
aqnkfimlnlmhettdknlspdgqyvprimfvdpsltvradiagrysnrlytyeprdlpl
lienmkkalrliqse

Timeline for d3ph9b_:

• d3ph9b_ first appeared in SCOPe 2.01
  
• d3ph9b_ appears in SCOPe 2.06
  
• d3ph9b_ appears in the current release, SCOPe 2.08