SCOPe 2.01: Domain d3ph9a_: 3ph9 A:

Lineage for d3ph9a_ (3ph9 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (6 PDB entries)

8. Domain d3ph9a_: 3ph9 A: [183738]
   automated match to d1sena_

Details for d3ph9a_

PDB Entry: 3ph9, 1.83 Å

PDB Description: Crystal structure of the human anterior gradient protein 3

PDB Compounds: (A:) Anterior gradient protein 3 homolog

SCOPe Domain Sequences for d3ph9a_:

Sequence; same for both SEQRES and ATOM records:

>d3ph9a_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqtlsrgwgdditwvqtyeeglfyaqkskkplmvihhledcqysqalkkvfaqneeiqem
aqnkfimlnlmhettdknlspdgqyvprimfvdpsltvradiagrysnrlytyeprdlpl
lienmkkalrliq

Timeline for d3ph9a_:

• d3ph9a_ is new in SCOPe 2.01-stable
  
• d3ph9a_ appears in SCOPe 2.02
  
• d3ph9a_ appears in the current release, SCOPe 2.08