SCOPe 2.08: Domain d3ph4b_: 3ph4 B:

Lineage for d3ph4b_ (3ph4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
   automatically mapped to Pfam PF02502

6. Protein automated matches [191284] (1 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [189908] (4 PDB entries)

8. Domain d3ph4b_: 3ph4 B: [183735]
   automated match to d1nn4d_
   complexed with aos

Details for d3ph4b_

PDB Entry: 3ph4, 2.07 Å

PDB Description: Clostridium thermocellum Ribose-5-Phosphate Isomerase B with d-allose

PDB Compounds: (B:) Ribose-5-phosphate isomerase

SCOPe Domain Sequences for d3ph4b_:

Sequence; same for both SEQRES and ATOM records:

>d3ph4b_ c.121.1.1 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]}
mkigigsdhggynlkreiadflkkrgyevidfgthgnesvdypdfglkvaeavksgecdr
givicgtglgisiaankvpgiraavctnsymarmsrehndanilalgervvgldlaldiv
dtwlkaefqggrhatrvgkigeiekkys

Timeline for d3ph4b_:

• d3ph4b_ first appeared in SCOPe 2.01
  
• d3ph4b_ appears in SCOPe 2.07