SCOPe 2.01: Domain d3ph4a_: 3ph4 A:

Lineage for d3ph4a_ (3ph4 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
   3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold

4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families)

5. Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)

6. Protein automated matches [191284] (1 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:203119] [189908] (2 PDB entries)

8. Domain d3ph4a_: 3ph4 A: [183734]
   automated match to d1nn4d_
   complexed with aos

Details for d3ph4a_

PDB Entry: 3ph4, 2.07 Å

PDB Description: Clostridium thermocellum Ribose-5-Phosphate Isomerase B with d-allose

PDB Compounds: (A:) Ribose-5-phosphate isomerase

SCOPe Domain Sequences for d3ph4a_:

Sequence; same for both SEQRES and ATOM records:

>d3ph4a_ c.121.1.1 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]}
mkigigsdhggynlkreiadflkkrgyevidfgthgnesvdypdfglkvaeavksgecdr
givicgtglgisiaankvpgiraavctnsymarmsrehndanilalgervvgldlaldiv
dtwlkaefqggrhatrvgkigeiekkys

Timeline for d3ph4a_:

• d3ph4a_ is new in SCOPe 2.01-stable
  
• d3ph4a_ appears in SCOPe 2.02
  
• d3ph4a_ appears in the current release, SCOPe 2.08