![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
![]() | Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) ![]() |
![]() | Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins) |
![]() | Protein automated matches [191284] (1 species) not a true protein |
![]() | Species Clostridium thermocellum [TaxId:203119] [189908] (2 PDB entries) |
![]() | Domain d3ph3b_: 3ph3 B: [183733] automated match to d1nn4d_ complexed with rb5 |
PDB Entry: 3ph3 (more details), 2.07 Å
SCOPe Domain Sequences for d3ph3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ph3b_ c.121.1.1 (B:) automated matches {Clostridium thermocellum [TaxId: 203119]} mkigigsdhggynlkreiadflkkrgyevidfgthgnesvdypdfglkvaeavksgecdr givicgtglgisiaankvpgiraavctnsymarmsrehndanilalgervvgldlaldiv dtwlkaefqggrhatrvgkigeiekkys
Timeline for d3ph3b_: