Lineage for d3ph3a_ (3ph3 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529227Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 2529228Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 2529229Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
    automatically mapped to Pfam PF02502
  6. 2529270Protein automated matches [191284] (1 species)
    not a true protein
  7. 2529271Species Clostridium thermocellum [TaxId:203119] [189908] (4 PDB entries)
  8. 2529278Domain d3ph3a_: 3ph3 A: [183732]
    automated match to d1nn4d_
    complexed with rb5

Details for d3ph3a_

PDB Entry: 3ph3 (more details), 2.07 Å

PDB Description: clostridium thermocellum ribose-5-phosphate isomerase b with d-ribose
PDB Compounds: (A:) Ribose-5-phosphate isomerase

SCOPe Domain Sequences for d3ph3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ph3a_ c.121.1.1 (A:) automated matches {Clostridium thermocellum [TaxId: 203119]}
mkigigsdhggynlkreiadflkkrgyevidfgthgnesvdypdfglkvaeavksgecdr
givicgtglgisiaankvpgiraavctnsymarmsrehndanilalgervvgldlaldiv
dtwlkaefqggrhatrvgkigeiekkys

SCOPe Domain Coordinates for d3ph3a_:

Click to download the PDB-style file with coordinates for d3ph3a_.
(The format of our PDB-style files is described here.)

Timeline for d3ph3a_: