Lineage for d3pgyb_ (3pgy B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131690Family c.67.1.4: GABA-aminotransferase-like [53417] (17 protein domains)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2131998Protein automated matches [190152] (22 species)
    not a true protein
  7. 2132057Species Staphylococcus aureus [TaxId:93062] [189536] (1 PDB entry)
  8. 2132059Domain d3pgyb_: 3pgy B: [183728]
    Other proteins in same PDB: d3pgyc2, d3pgyd2
    automated match to d1kkja_
    complexed with cit, edo, gly; mutant

Details for d3pgyb_

PDB Entry: 3pgy (more details), 1.92 Å

PDB Description: serine hydroxymethyltransferase from staphylococcus aureus, s95p mutant.
PDB Compounds: (B:) serine hydroxymethyltransferase

SCOPe Domain Sequences for d3pgyb_:

Sequence, based on SEQRES records: (download)

>d3pgyb_ c.67.1.4 (B:) automated matches {Staphylococcus aureus [TaxId: 93062]}
msyitkqdkviaeaierefqrqnsnieliasenfvseavmeaqgsvltnkyaegypgrry
yggcefvdvtesiaidrakalfgaehvnvqphsgpqanmavylvalemgdtvlgmnlshg
ghlthgapvnfsgkfynfveygvdkdterinydevrklalehkpklivagasaysrtidf
kkfkeiadevnaklmvdmahiaglvaaglhpnpveyadfvtttthktlrgprggmilcke
eykkdidktifpgiqggplehviaakavafgealennfktyqqqvvknakvlaealineg
frivsggtdnhlvavdvkgsigltgkeaeetldsvgitcnkntipfdqekpfvtsgirlg
tpaattrgfdekafeevakiislalknskdeeklqqakervakltaeyply

Sequence, based on observed residues (ATOM records): (download)

>d3pgyb_ c.67.1.4 (B:) automated matches {Staphylococcus aureus [TaxId: 93062]}
msyitkqdkviaeaierefqrqnsnieliasenfvseavmeaqgsvltnkyaegypgrry
yggcefvdvtesiaidrakalfgaehvnvqphsgpqanmavylvalemgdtvlgmnlsha
pvnfsgkfynfveygvdkdterinydevrklalehkpklivagasaysrtidfkkfkeia
devnaklmvdmahiaglvaaglhpnpveyadfvtttthktlrgprggmilckeeykkdid
ktifpgiqggplehviaakavafgealennfktyqqqvvknakvlaealinegfrivsgg
tdnhlvavdvkgsigltgkeaeetldsvgitcnkntipfdqekpfvtsgirlgtpaattr
gfdekafeevakiislalknskdeeklqqakervakltaeyply

SCOPe Domain Coordinates for d3pgyb_:

Click to download the PDB-style file with coordinates for d3pgyb_.
(The format of our PDB-style files is described here.)

Timeline for d3pgyb_: