Lineage for d1c9ba1 (1c9b A:110-207)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4853Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 4854Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 4899Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)
  6. 4900Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)
  7. 4901Species Human (Homo sapiens) [TaxId:9606] [47967] (3 PDB entries)
  8. 4904Domain d1c9ba1: 1c9b A:110-207 [18372]
    Other proteins in same PDB: d1c9bb1, d1c9bb2, d1c9bf1, d1c9bf2, d1c9bj1, d1c9bj2, d1c9bn1, d1c9bn2, d1c9br1, d1c9br2

Details for d1c9ba1

PDB Entry: 1c9b (more details), 2.65 Å

PDB Description: crystal structure of a human tbp core domain-human tfiib core domain complex bound to an extended, modified adenoviral major late promoter (admlp)

SCOP Domain Sequences for d1c9ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ba1 a.74.1.2 (A:110-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens)}
sdrammnafkeittmadrinlprnivdrtnnlfkqvyeqkslkgrandaiasaclyiacr
qegvprtfkeicavsriskkeigrcfklilkaletsvd

SCOP Domain Coordinates for d1c9ba1:

Click to download the PDB-style file with coordinates for d1c9ba1.
(The format of our PDB-style files is described here.)

Timeline for d1c9ba1: