Lineage for d3pgla_ (3pgl A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011158Family c.108.1.16: NLI interacting factor-like phosphatase [110509] (2 proteins)
    Pfam PF03031; NIF; the insertion subdomain is a 3-stranded beta-sheet;
  6. 1011163Protein automated matches [190659] (1 species)
    not a true protein
  7. 1011164Species Human (Homo sapiens) [TaxId:9606] [187808] (8 PDB entries)
  8. 1011177Domain d3pgla_: 3pgl A: [183716]
    automated match to d1t9za_
    complexed with mg, rzx

Details for d3pgla_

PDB Entry: 3pgl (more details), 2.35 Å

PDB Description: crystal structure of human small c-terminal domain phosphatase 1 (scp1) bound to rabeprazole
PDB Compounds: (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1

SCOPe Domain Sequences for d3pgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pgla_ c.108.1.16 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qyllpeakaqdsdkicvvidldetlvhssfkpvnnadfiipveidgvvhqvyvlkrphvd
eflqrmgelfecvlftaslakyadpvadlldkwgafrarlfrescvfhrgnyvkdlsrlg
rdlrrvlildnspasyvfhpdnavpvaswfdnmsdtelhdllpffeqlsrvddvysvlrq

SCOPe Domain Coordinates for d3pgla_:

Click to download the PDB-style file with coordinates for d3pgla_.
(The format of our PDB-style files is described here.)

Timeline for d3pgla_: