SCOPe 2.06: Domain d1vola2: 1vol A:208-316

Lineage for d1vola2 (1vol A:208-316)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)

6. Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47967] (4 PDB entries)

8. Domain d1vola2: 1vol A:208-316 [18371]
   Other proteins in same PDB: d1volb1, d1volb2
   protein/DNA complex

Details for d1vola2

PDB Entry: 1vol, 2.7 Å

PDB Description: tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex

PDB Compounds: (A:) protein (transcription factor iib (tfiib))

SCOPe Domain Sequences for d1vola2:

Sequence; same for both SEQRES and ATOM records:

>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]}
littgdfmsrfcsnlclpkqvqmaathiarkaveldlvpgrspisvaaaaiymasqasae
krtqkeigdiagvadvtirqsyrliyprapdlfptdfkfdtpvdklpql

Timeline for d1vola2:

• d1vola2 first appeared (with stable ids) in SCOP 1.55
  
• d1vola2 appears in SCOPe 2.05
  
• d1vola2 appears in SCOPe 2.07
  
• d1vola2 appears in the current release, SCOPe 2.08