SCOP 1.69: Domain d1vola2: 1vol A:208-316

Lineage for d1vola2 (1vol A:208-316)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)

6. Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47967] (3 PDB entries)

8. Domain d1vola2: 1vol A:208-316 [18371]
   Other proteins in same PDB: d1volb1, d1volb2

Details for d1vola2

PDB Entry: 1vol, 2.7 Å

PDB Description: tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex

SCOP Domain Sequences for d1vola2:

Sequence; same for both SEQRES and ATOM records:

>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens)}
littgdfmsrfcsnlclpkqvqmaathiarkaveldlvpgrspisvaaaaiymasqasae
krtqkeigdiagvadvtirqsyrliyprapdlfptdfkfdtpvdklpql

Timeline for d1vola2:

• d1vola2 first appeared (with stable ids) in SCOP 1.55
  
• d1vola2 appears in SCOP 1.67
  
• d1vola2 appears in SCOP 1.71
  
• d1vola2 appears in the current release, SCOPe 2.08