Lineage for d3pfxa_ (3pfx A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779993Protein automated matches [190170] (17 species)
    not a true protein
  7. 2780047Species Talaromyces emersonii [TaxId:68825] [189786] (4 PDB entries)
  8. 2780050Domain d3pfxa_: 3pfx A: [183702]
    automated match to d1q9ha_
    complexed with so4

Details for d3pfxa_

PDB Entry: 3pfx (more details), 1.26 Å

PDB Description: crystal structure of cel7a from talaromyces emersonii in complex with cellobiose
PDB Compounds: (A:) Cellobiohydrolase 1 catalytic domain

SCOPe Domain Sequences for d3pfxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pfxa_ b.29.1.10 (A:) automated matches {Talaromyces emersonii [TaxId: 68825]}
eqagtataenhppltwqectapgscttqngavvldanwrwvhdvngytncytgntwdpty
cpddetcaqncaldgadyegtygvtssgsslklnfvtgsnvgsrlyllqddstyqifkll
nrefsfdvdvsnlpcglngalyfvamdadggvskypnnkagakygtgycdsqcprdlkfi
dgeanvegwqpssnnantgigdhgsccaemdvweansisnavtphpcdtpgqtmcsgddc
ggtysndryagtcdpdgcdfnpyrmgntsfygpgkiidttkpftvvtqfltddgtdtgtl
seikrfyiqnsnvipqpnsdisgvtgnsittefctaqkqafgdtddfsqhgglakmgaam
qqgmvlvmslwddyaaqmlwldsdyptdadpttpgiargtcptdsgvpsdvesqspnsyv
tysnikfgpinstfta

SCOPe Domain Coordinates for d3pfxa_:

Click to download the PDB-style file with coordinates for d3pfxa_.
(The format of our PDB-style files is described here.)

Timeline for d3pfxa_: