SCOPe 2.01: Domain d3pfua_: 3pfu A:

Lineage for d3pfua_ (3pfu A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (1 family)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)

6. Protein automated matches [191289] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189942] (1 PDB entry)

8. Domain d3pfua_: 3pfu A: [183701]
   automated match to d1vrsa1
   complexed with dtt

Details for d3pfua_

PDB Entry: 3pfu, 1.8 Å

PDB Description: n-terminal domain of thiol:disulfide interchange protein dsbd in its reduced form

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d3pfua_:

Sequence; same for both SEQRES and ATOM records:

>d3pfua_ b.1.17.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
grsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwh
edefygkseiyrdrltlpvtinqasagatltvtyqgcadagfcyppetktvplsevvan

Timeline for d3pfua_:

• d3pfua_ is new in SCOPe 2.01-stable
  
• d3pfua_ appears in SCOPe 2.02
  
• d3pfua_ appears in the current release, SCOPe 2.08