Lineage for d3pfua_ (3pfu A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765029Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) (S)
  5. 2765030Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)
  6. 2765044Protein automated matches [191289] (2 species)
    not a true protein
  7. 2765045Species Escherichia coli K-12 [TaxId:83333] [189942] (1 PDB entry)
  8. 2765046Domain d3pfua_: 3pfu A: [183701]
    automated match to d1vrsa1
    complexed with dtt

Details for d3pfua_

PDB Entry: 3pfu (more details), 1.8 Å

PDB Description: n-terminal domain of thiol:disulfide interchange protein dsbd in its reduced form
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d3pfua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pfua_ b.1.17.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
grsqfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwh
edefygkseiyrdrltlpvtinqasagatltvtyqgcadagfcyppetktvplsevvan

SCOPe Domain Coordinates for d3pfua_:

Click to download the PDB-style file with coordinates for d3pfua_.
(The format of our PDB-style files is described here.)

Timeline for d3pfua_: