SCOPe 2.04: Domain d1vola1: 1vol A:113-207

Lineage for d1vola1 (1vol A:113-207)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)

6. Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47967] (4 PDB entries)

8. Domain d1vola1: 1vol A:113-207 [18370]
   Other proteins in same PDB: d1volb1, d1volb2
   protein/DNA complex

Details for d1vola1

PDB Entry: 1vol, 2.7 Å

PDB Description: tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex

PDB Compounds: (A:) protein (transcription factor iib (tfiib))

SCOPe Domain Sequences for d1vola1:

Sequence; same for both SEQRES and ATOM records:

>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]}
ammnafkeittmadrinlprnkvdrtnnlfrqayeqkslkgrandaiasaclyiacrqeg
vprtfkeicavsriskkeigrcfklilkaletsvd

Timeline for d1vola1:

• d1vola1 first appeared (with stable ids) in SCOP 1.55
  
• d1vola1 appears in SCOPe 2.03
  
• d1vola1 appears in SCOPe 2.05
  
• d1vola1 appears in the current release, SCOPe 2.08