Lineage for d1vola1 (1vol A:113-207)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4853Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 4854Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 4899Family a.74.1.2: Transcription factor IIB (TFIIB), core domain [47965] (1 protein)
  6. 4900Protein Transcription factor IIB (TFIIB), core domain [47966] (2 species)
  7. 4901Species Human (Homo sapiens) [TaxId:9606] [47967] (3 PDB entries)
  8. 4902Domain d1vola1: 1vol A:113-207 [18370]
    Other proteins in same PDB: d1volb1, d1volb2

Details for d1vola1

PDB Entry: 1vol (more details), 2.7 Å

PDB Description: tfiib (human core domain)/tbp (a.thaliana)/tata element ternary complex

SCOP Domain Sequences for d1vola1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens)}
ammnafkeittmadrinlprnkvdrtnnlfrqayeqkslkgrandaiasaclyiacrqeg
vprtfkeicavsriskkeigrcfklilkaletsvd

SCOP Domain Coordinates for d1vola1:

Click to download the PDB-style file with coordinates for d1vola1.
(The format of our PDB-style files is described here.)

Timeline for d1vola1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vola2