SCOPe 2.06: Domain d3pfta_: 3pft A:

Lineage for d3pfta_ (3pft A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.0: automated matches [191365] (1 protein)
   not a true family

6. Protein automated matches [190439] (20 species)
   not a true protein

7. Species Mycobacterium goodii [TaxId:134601] [189785] (1 PDB entry)

8. Domain d3pfta_: 3pft A: [183699]
   automated match to d1rz0a_
   complexed with fmn; mutant

Details for d3pfta_

PDB Entry: 3pft, 1.6 Å

PDB Description: crystal structure of untagged c54a mutant flavin reductase (dszd) in complex with fmn from mycobacterium goodii

PDB Compounds: (A:) flavin reductase

SCOPe Domain Sequences for d3pfta_:

Sequence; same for both SEQRES and ATOM records:

>d3pfta_ b.45.1.0 (A:) automated matches {Mycobacterium goodii [TaxId: 134601]}
dlsptslreafghfpsgviaiaaevdgtrvglaastfvpvslepplvafavqnssttwpk
lkdlpslgisvlgeahdtaartlaaktgdrfagletesrdsgavfingtsvwlesaieql
vpagdhtivvlrvsdivineavppivfhrsafrklg

Timeline for d3pfta_:

• d3pfta_ first appeared in SCOPe 2.01
  
• d3pfta_ appears in SCOPe 2.05
  
• d3pfta_ appears in SCOPe 2.07
  
• d3pfta_ appears in the current release, SCOPe 2.08