SCOPe 2.01: Domain d3pf4a_: 3pf4 A:

Lineage for d3pf4a_ (3pf4 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [50285] (10 PDB entries)

8. Domain d3pf4a_: 3pf4 A: [183692]
   automated match to d1cspa_
   protein/DNA complex; protein/RNA complex; complexed with mg, na

Details for d3pf4a_

PDB Entry: 3pf4, 1.38 Å

PDB Description: Crystal structure of Bs-CspB in complex with r(GUCUUUA)

PDB Compounds: (A:) Cold shock protein cspB

SCOPe Domain Sequences for d3pf4a_:

Sequence; same for both SEQRES and ATOM records:

>d3pf4a_ b.40.4.5 (A:) Major cold shock protein {Bacillus subtilis [TaxId: 1423]}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtke

Timeline for d3pf4a_:

• d3pf4a_ is new in SCOPe 2.01-stable
  
• d3pf4a_ appears in SCOPe 2.02
  
• d3pf4a_ appears in the current release, SCOPe 2.08