Lineage for d3pelb_ (3pel B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300445Species Dog (Canis familiaris) [TaxId:9615] [158218] (3 PDB entries)
  8. 2300446Domain d3pelb_: 3pel B: [183686]
    Other proteins in same PDB: d3pela_
    automated match to d1fhjb_
    complexed with hem

Details for d3pelb_

PDB Entry: 3pel (more details), 1.9 Å

PDB Description: Structure of Greyhound Hemoglobin: Origin of High Oxygen Affinity
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3pelb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pelb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Dog (Canis familiaris) [TaxId: 9615]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d3pelb_:

Click to download the PDB-style file with coordinates for d3pelb_.
(The format of our PDB-style files is described here.)

Timeline for d3pelb_: