SCOPe 2.01: Domain d3pedb_: 3ped B:

Lineage for d3pedb_ (3ped B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (13 PDB entries)

8. Domain d3pedb_: 3ped B: [183683]
   automated match to d1ngla_
   complexed with fe, so4, zyf

Details for d3pedb_

PDB Entry: 3ped, 2.3 Å

PDB Description: Siderocalin Recognitin of Carboxymycobactins: Interference by the immune system in intracellular iron acquisition by Mycobacteria tuberculosis

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3pedb_:

Sequence, based on SEQRES records:

>d3pedb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records):

>d3pedb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailrekdpqkmyatiyelkedksyn
vtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkk
vsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d3pedb_:

• d3pedb_ is new in SCOPe 2.01-stable
  
• d3pedb_ appears in SCOPe 2.02
  
• d3pedb_ appears in the current release, SCOPe 2.08