SCOPe 2.07: Domain d3pecc_: 3pec C:

Lineage for d3pecc_ (3pec C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)

8. Domain d3pecc_: 3pec C: [183681]
   automated match to d1ngla_
   complexed with fe, gol, na, so4, zyg

Details for d3pecc_

PDB Entry: 3pec, 2.19 Å

PDB Description: Siderocalin Recognitin of Carboxymycobactins: Interference by the immune system in intracellular iron acquisition by Mycobacteria tuberculosis

PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3pecc_:

Sequence; same for both SEQRES and ATOM records:

>d3pecc_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Timeline for d3pecc_:

• d3pecc_ first appeared in SCOPe 2.01
  
• d3pecc_ appears in SCOPe 2.06
  
• d3pecc_ appears in the current release, SCOPe 2.08