Lineage for d3pdxa_ (3pdx A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897457Species Mouse (Mus musculus) [TaxId:10090] [188700] (8 PDB entries)
  8. 2897472Domain d3pdxa_: 3pdx A: [183676]
    automated match to d1bw0a_

Details for d3pdxa_

PDB Entry: 3pdx (more details), 2.91 Å

PDB Description: Crystal structural of mouse tyrosine aminotransferase
PDB Compounds: (A:) Tyrosine aminotransferase

SCOPe Domain Sequences for d3pdxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pdxa_ c.67.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kvkpnpnktvislsigdptvfgnlptdpevtqamkdaldsgkyngyapsigylssreeva
syyhcpeapleakdviltsgcsqaielclavlanpgqniliprpgfslyrtlaesmgiev
klynllpeksweidlkqleslidektaclvvnnpsnpcgsvfskrhlqkilavaerqcvp
iladeiygdmvfsdckyepmatlstnvpilscgglakrwlvpgwrlgwilihdrrdifgn
eirdglvklsqrilgpctivqgalksilqrtpqefyqdtlsflksnadlcygalsaipgl
qpvrpsgamylmvgiemehfpefendvefterliaeqsvhclpatcfeypnffrvvitvp
evmmleacsriqefceqhy

SCOPe Domain Coordinates for d3pdxa_:

Click to download the PDB-style file with coordinates for d3pdxa_.
(The format of our PDB-style files is described here.)

Timeline for d3pdxa_: