Lineage for d3pdwa_ (3pdw A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1187611Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1187612Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1188163Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1188164Protein automated matches [190447] (25 species)
    not a true protein
  7. 1188175Species Bacillus subtilis [TaxId:1423] [188499] (4 PDB entries)
  8. 1188176Domain d3pdwa_: 3pdw A: [183675]
    automated match to d1ydfa1
    complexed with acy, gol

Details for d3pdwa_

PDB Entry: 3pdw (more details), 1.6 Å

PDB Description: crystal structure of putative p-nitrophenyl phosphatase from bacillus subtilis
PDB Compounds: (A:) Uncharacterized hydrolase yutF

SCOPe Domain Sequences for d3pdwa_:

Sequence, based on SEQRES records: (download)

>d3pdwa_ c.108.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
slktykgylidldgtmyngtekieeacefvrtlkdrgvpylfvtnnssrtpkqvadklvs
fdipateeqvfttsmataqhiaqqkkdasvyvigeegirqaieengltfggenadfvvvg
idrsityekfavgclairngarfistngdiaiptergllpgngsltsvltvstgvqpvfi
gkpesiimeqamrvlgtdvsetlmvgdnyatdimaginagmdtllvhtgvtkrehmtddm
ekpthaidsltewipyieghhhh

Sequence, based on observed residues (ATOM records): (download)

>d3pdwa_ c.108.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
slktykgylidldgtmyngtekieeacefvrtlkdrgvpylfvtnnssrtpkqvadklvs
fdipateeqvfttsmataqhiaqqkkdasvyvigeegirqaieengltfggenadfvvvg
idrsityekfavgclairngarfistngdiaiptergllpgngsltsvltvstgvqpvfi
gkpesiimeqamrvlgtdvsetlmvgdnyatdimaginagmdtllvhtgmtddmekptha
idsltewipyieghhhh

SCOPe Domain Coordinates for d3pdwa_:

Click to download the PDB-style file with coordinates for d3pdwa_.
(The format of our PDB-style files is described here.)

Timeline for d3pdwa_: