Lineage for d3pdwa1 (3pdw A:4-258)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148571Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2148572Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2149297Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2149298Protein automated matches [190447] (51 species)
    not a true protein
  7. 2149319Species Bacillus subtilis [TaxId:1423] [188499] (5 PDB entries)
  8. 2149320Domain d3pdwa1: 3pdw A:4-258 [183675]
    Other proteins in same PDB: d3pdwa2, d3pdwa3
    automated match to d1ydfa1
    complexed with acy, gol

Details for d3pdwa1

PDB Entry: 3pdw (more details), 1.6 Å

PDB Description: Crystal structure of putative p-nitrophenyl phosphatase from Bacillus subtilis
PDB Compounds: (A:) Uncharacterized hydrolase yutF

SCOPe Domain Sequences for d3pdwa1:

Sequence, based on SEQRES records: (download)

>d3pdwa1 c.108.1.0 (A:4-258) automated matches {Bacillus subtilis [TaxId: 1423]}
ktykgylidldgtmyngtekieeacefvrtlkdrgvpylfvtnnssrtpkqvadklvsfd
ipateeqvfttsmataqhiaqqkkdasvyvigeegirqaieengltfggenadfvvvgid
rsityekfavgclairngarfistngdiaiptergllpgngsltsvltvstgvqpvfigk
pesiimeqamrvlgtdvsetlmvgdnyatdimaginagmdtllvhtgvtkrehmtddmek
pthaidsltewipyi

Sequence, based on observed residues (ATOM records): (download)

>d3pdwa1 c.108.1.0 (A:4-258) automated matches {Bacillus subtilis [TaxId: 1423]}
ktykgylidldgtmyngtekieeacefvrtlkdrgvpylfvtnnssrtpkqvadklvsfd
ipateeqvfttsmataqhiaqqkkdasvyvigeegirqaieengltfggenadfvvvgid
rsityekfavgclairngarfistngdiaiptergllpgngsltsvltvstgvqpvfigk
pesiimeqamrvlgtdvsetlmvgdnyatdimaginagmdtllvhtgmtddmekpthaid
sltewipyi

SCOPe Domain Coordinates for d3pdwa1:

Click to download the PDB-style file with coordinates for d3pdwa1.
(The format of our PDB-style files is described here.)

Timeline for d3pdwa1: