Lineage for d3pdjb1 (3pdj B:24-292)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841402Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 2841418Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
    Uniprot P28845
  8. 2841446Domain d3pdjb1: 3pdj B:24-292 [183674]
    Other proteins in same PDB: d3pdja2, d3pdjb2
    automated match to d1xu9b_
    complexed with 3pj, nap

Details for d3pdjb1

PDB Entry: 3pdj (more details), 2.3 Å

PDB Description: Crystal Structure of Human 11-beta-Hydroxysteroid Dehydrogenase 1 (11b-HSD1) in Complex with 4,4-Disubstituted Cyclohexylbenzamide Inhibitor
PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d3pdjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pdjb1 c.2.1.2 (B:24-292) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydsslw
ttllirnpsrkileflystsynmdrfink

SCOPe Domain Coordinates for d3pdjb1:

Click to download the PDB-style file with coordinates for d3pdjb1.
(The format of our PDB-style files is described here.)

Timeline for d3pdjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pdjb2