SCOPe 2.06: Domain d3pdbb_: 3pdb B:

Lineage for d3pdbb_ (3pdb B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein automated matches [190317] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189353] (3 PDB entries)

8. Domain d3pdbb_: 3pdb B: [183669]
   automated match to d1akaa_
   complexed with bme, gol, oaa, pmp

Details for d3pdbb_

PDB Entry: 3pdb, 2.4 Å

PDB Description: Crystal structure of mouse mitochondrial aspartate aminotransferase in complex with oxaloacetic acid

PDB Compounds: (B:) Aspartate aminotransferase, mitochondrial

SCOPe Domain Sequences for d3pdbb_:

Sequence; same for both SEQRES and ATOM records:

>d3pdbb_ c.67.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sswwthvemgppdpilgvteafkrdtnskkmnlgvgayrddngkpyvlpsvrkaeaqiaa
knldkeylpigglaefckasaelalgennevlksgrfvtvqtisgtgalrvgasflqrff
kfsrdvflpkpswgnhtpifrdagmqlqgyryydpktcgfdfsgalediskipeqsvlll
hacahnptgvdprpeqwkeiasvvkkknlfaffdmayqgfasgdgdkdawavrhfieqgi
nvclcqsyaknmglygervgaftvvckdaeeakrvesqlkilirplysnpplngariaat
iltspdlrkqwlqevkgmadriismrtqlvsnlkkegsshnwqhitdqigmfcftglkpe
qverltkefsvymtkdgrisvagvtsgnvgylahaihqvtk

Timeline for d3pdbb_:

• d3pdbb_ first appeared in SCOPe 2.01
  
• d3pdbb_ appears in SCOPe 2.05
  
• d3pdbb_ appears in SCOPe 2.07
  
• d3pdbb_ appears in the current release, SCOPe 2.08