| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (4 proteins) |
| Protein Viral cyclin [47961] (3 species) |
| Species Kaposi's sarcoma-associated virus [47964] (1 PDB entry) |
| Domain d1g3nc1: 1g3n C:16-147 [18366] Other proteins in same PDB: d1g3na_, d1g3nb_, d1g3ne_, d1g3nf_ |
PDB Entry: 1g3n (more details), 2.9 Å
SCOP Domain Sequences for d1g3nc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated virus}
lcedrifynileieprfltsdsvfgtfqqsltshmrkllgtwmfsvcqeynlepnvvala
lnlldrlllikqvskehfqktgsacllvasklrsltpistsslcyaaadsfsrqelidqe
kelleklawrte
Timeline for d1g3nc1: