Lineage for d3pd6a_ (3pd6 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895545Protein automated matches [190317] (4 species)
    not a true protein
  7. 2895588Species Mouse (Mus musculus) [TaxId:10090] [189353] (3 PDB entries)
  8. 2895593Domain d3pd6a_: 3pd6 A: [183659]
    automated match to d1akaa_
    complexed with gol, kyn, pmp

Details for d3pd6a_

PDB Entry: 3pd6 (more details), 2.4 Å

PDB Description: Crystal structure of mouse mitochondrial aspartate aminotransferase, a newly identified kynurenine aminotransferase-IV
PDB Compounds: (A:) Aspartate aminotransferase, mitochondrial

SCOPe Domain Sequences for d3pd6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pd6a_ c.67.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sswwthvemgppdpilgvteafkrdtnskkmnlgvgayrddngkpyvlpsvrkaeaqiaa
knldkeylpigglaefckasaelalgennevlksgrfvtvqtisgtgalrvgasflqrff
kfsrdvflpkpswgnhtpifrdagmqlqgyryydpktcgfdfsgalediskipeqsvlll
hacahnptgvdprpeqwkeiasvvkkknlfaffdmayqgfasgdgdkdawavrhfieqgi
nvclcqsyaknmglygervgaftvvckdaeeakrvesqlkilirplysnpplngariaat
iltspdlrkqwlqevkgmadriismrtqlvsnlkkegsshnwqhitdqigmfcftglkpe
qverltkefsvymtkdgrisvagvtsgnvgylahaihqvtk

SCOPe Domain Coordinates for d3pd6a_:

Click to download the PDB-style file with coordinates for d3pd6a_.
(The format of our PDB-style files is described here.)

Timeline for d3pd6a_: