Lineage for d3pcwa_ (3pcw A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1130027Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1130028Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1131149Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1131671Protein automated matches [190156] (4 species)
    not a true protein
  7. 1131674Species Cryphonectria parasitica [TaxId:5116] [187236] (21 PDB entries)
  8. 1131676Domain d3pcwa_: 3pcw A: [183654]
    automated match to d1e5oe_
    complexed with dms, fbf, gol

Details for d3pcwa_

PDB Entry: 3pcw (more details), 1.25 Å

PDB Description: Endothiapepsin in complex with a fragment
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d3pcwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcwa_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d3pcwa_:

Click to download the PDB-style file with coordinates for d3pcwa_.
(The format of our PDB-style files is described here.)

Timeline for d3pcwa_: