Lineage for d3pcua_ (3pcu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729438Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 2729439Species Human (Homo sapiens) [TaxId:9606] [48511] (38 PDB entries)
    Uniprot P19793 227-458
  8. 2729449Domain d3pcua_: 3pcu A: [183653]
    automated match to d1fbya_
    complexed with lx8

Details for d3pcua_

PDB Entry: 3pcu (more details), 2 Å

PDB Description: crystal structure of human retinoic x receptor alpha ligand-binding domain complexed with lx0278 and src1 peptide
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d3pcua_:

Sequence, based on SEQRES records: (download)

>d3pcua_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriph
fselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdr
vltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhky
peqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d3pcua_ a.123.1.1 (A:) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dmpverileaelavedpvtnicqaadkqlftlvewakriphfselplddqvillragwne
lliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktel
gclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrs
iglkclehlfffkligdtpidtflmemleap

SCOPe Domain Coordinates for d3pcua_:

Click to download the PDB-style file with coordinates for d3pcua_.
(The format of our PDB-style files is described here.)

Timeline for d3pcua_: