SCOPe 2.06: Domain d3pc8c1: 3pc8 C:846-921

Lineage for d3pc8c1 (3pc8 C:846-921)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (6 families)
   Pfam PF00533

5. Family c.15.1.2: DNA ligase [52117] (3 proteins)

6. Protein automated matches [191252] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189784] (3 PDB entries)

8. Domain d3pc8c1: 3pc8 C:846-921 [183651]
   Other proteins in same PDB: d3pc8a_, d3pc8b_, d3pc8c2, d3pc8d2
   automated match to d1imoa_
   protein/DNA complex; complexed with mg, trs

Details for d3pc8c1

PDB Entry: 3pc8, 2.31 Å

PDB Description: X-ray crystal structure of the heterodimeric complex of XRCC1 and DNA ligase III-alpha BRCT domains.

PDB Compounds: (C:) DNA ligase 3

SCOPe Domain Sequences for d3pc8c1:

Sequence; same for both SEQRES and ATOM records:

>d3pc8c1 c.15.1.2 (C:846-921) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrdknpaaqqvs
pewiwacirkrrlvap

Timeline for d3pc8c1:

• d3pc8c1 first appeared in SCOPe 2.01, called d3pc8c_
  
• d3pc8c1 was called d3pc8c_ in SCOPe 2.05
  
• d3pc8c1 appears in SCOPe 2.07
  
• d3pc8c1 appears in the current release, SCOPe 2.08