SCOP 1.67: Domain d1f5qd2: 1f5q D:147-252

Lineage for d1f5qd2 (1f5q D:147-252)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Viral cyclin [47961] (3 species)

7. Species Murine herpes virus gamma 68 [47963] (1 PDB entry)

8. Domain d1f5qd2: 1f5q D:147-252 [18365]
   Other proteins in same PDB: d1f5qa_, d1f5qc_
   complexed with cl

Details for d1f5qd2

PDB Entry: 1f5q, 2.5 Å

PDB Description: crystal structure of murine gamma herpesvirus cyclin complexed to human cyclin dependent kinase 2

SCOP Domain Sequences for d1f5qd2:

Sequence; same for both SEQRES and ATOM records:

>d1f5qd2 a.74.1.1 (D:147-252) Viral cyclin {Murine herpes virus gamma 68}
clstdlicyilhimhapredylniynlcrpkifcalcdgrsamkrpvlitlacmhltmnq
kydyyenridgvckslyitkeelhqccdlvdiaivsfdenyfkina

Timeline for d1f5qd2:

• d1f5qd2 first appeared (with stable ids) in SCOP 1.55
  
• d1f5qd2 appears in SCOP 1.65
  
• d1f5qd2 appears in SCOP 1.69
  
• d1f5qd2 appears in the current release, SCOPe 2.08