Lineage for d1f5qd2 (1f5q D:147-252)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718531Protein Viral cyclin [47961] (3 species)
  7. 2718552Species Murine herpesvirus 68 [TaxId:33708] [47963] (1 PDB entry)
  8. 2718556Domain d1f5qd2: 1f5q D:147-252 [18365]
    Other proteins in same PDB: d1f5qa_, d1f5qc_
    complexed with cl

Details for d1f5qd2

PDB Entry: 1f5q (more details), 2.5 Å

PDB Description: crystal structure of murine gamma herpesvirus cyclin complexed to human cyclin dependent kinase 2
PDB Compounds: (D:) gamma herpesvirus cyclin

SCOPe Domain Sequences for d1f5qd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5qd2 a.74.1.1 (D:147-252) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]}
clstdlicyilhimhapredylniynlcrpkifcalcdgrsamkrpvlitlacmhltmnq
kydyyenridgvckslyitkeelhqccdlvdiaivsfdenyfkina

SCOPe Domain Coordinates for d1f5qd2:

Click to download the PDB-style file with coordinates for d1f5qd2.
(The format of our PDB-style files is described here.)

Timeline for d1f5qd2: