Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.15.1: BRCT domain [52113] (6 families) Pfam PF00533 |
Family c.15.1.1: DNA-repair protein XRCC1 [52114] (2 proteins) |
Protein automated matches [191251] (1 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189783] (3 PDB entries) |
Domain d3pc8a_: 3pc8 A: [183649] Other proteins in same PDB: d3pc8c_, d3pc8d_ automated match to d1cdza_ protein/DNA complex; complexed with mg, trs |
PDB Entry: 3pc8 (more details), 2.31 Å
SCOPe Domain Sequences for d3pc8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pc8a_ c.15.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} mpelpdffegkhfflygefpgderrrliryvtafngeledrmnervqfvitaqewdpnfe ealmenpslafvrprwiyscnekqkllphqlygvvpq
Timeline for d3pc8a_: