Lineage for d3pc8a_ (3pc8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854448Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854449Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 2854450Family c.15.1.1: DNA-repair protein XRCC1 [52114] (2 proteins)
  6. 2854457Protein automated matches [191251] (1 species)
    not a true protein
  7. 2854458Species Mouse (Mus musculus) [TaxId:10090] [189783] (3 PDB entries)
  8. 2854459Domain d3pc8a_: 3pc8 A: [183649]
    Other proteins in same PDB: d3pc8c1, d3pc8c2, d3pc8d1, d3pc8d2
    automated match to d1cdza_
    protein/DNA complex; complexed with mg, trs

Details for d3pc8a_

PDB Entry: 3pc8 (more details), 2.31 Å

PDB Description: X-ray crystal structure of the heterodimeric complex of XRCC1 and DNA ligase III-alpha BRCT domains.
PDB Compounds: (A:) DNA repair protein XRCC1

SCOPe Domain Sequences for d3pc8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pc8a_ c.15.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mpelpdffegkhfflygefpgderrrliryvtafngeledrmnervqfvitaqewdpnfe
ealmenpslafvrprwiyscnekqkllphqlygvvpq

SCOPe Domain Coordinates for d3pc8a_:

Click to download the PDB-style file with coordinates for d3pc8a_.
(The format of our PDB-style files is described here.)

Timeline for d3pc8a_: