SCOPe 2.06: Domain d3pc7a_: 3pc7 A:

Lineage for d3pc7a_ (3pc7 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (6 families)
   Pfam PF00533

5. Family c.15.1.2: DNA ligase [52117] (3 proteins)

6. Protein automated matches [191252] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189784] (3 PDB entries)

8. Domain d3pc7a_: 3pc7 A: [183647]
   automated match to d1imoa_

Details for d3pc7a_

PDB Entry: 3pc7, 1.65 Å

PDB Description: x-ray crystal structure of the dna ligase iii-alpha brct domain.

PDB Compounds: (A:) DNA ligase 3

SCOPe Domain Sequences for d3pc7a_:

Sequence; same for both SEQRES and ATOM records:

>d3pc7a_ c.15.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrdknpaa
qqvspewiwacirkrrlvaps

Timeline for d3pc7a_:

• d3pc7a_ first appeared in SCOPe 2.01
  
• d3pc7a_ appears in SCOPe 2.05
  
• d3pc7a_ appears in SCOPe 2.07
  
• d3pc7a_ appears in the current release, SCOPe 2.08