Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.15.1: BRCT domain [52113] (6 families) Pfam PF00533 |
Family c.15.1.2: DNA ligase [52117] (3 proteins) |
Protein automated matches [191252] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189784] (4 PDB entries) |
Domain d3pc7a_: 3pc7 A: [183647] automated match to d1imoa_ |
PDB Entry: 3pc7 (more details), 1.65 Å
SCOPe Domain Sequences for d3pc7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pc7a_ c.15.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrdknpaa qqvspewiwacirkrrlvaps
Timeline for d3pc7a_: