Lineage for d3pc6a1 (3pc6 A:536-631)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854448Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854449Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 2854450Family c.15.1.1: DNA-repair protein XRCC1 [52114] (2 proteins)
  6. 2854457Protein automated matches [191251] (1 species)
    not a true protein
  7. 2854458Species Mouse (Mus musculus) [TaxId:10090] [189783] (3 PDB entries)
  8. 2854461Domain d3pc6a1: 3pc6 A:536-631 [183645]
    Other proteins in same PDB: d3pc6a2, d3pc6b2
    automated match to d1cdza_

Details for d3pc6a1

PDB Entry: 3pc6 (more details), 1.9 Å

PDB Description: x-ray crystal structure of the second xrcc1 brct domain.
PDB Compounds: (A:) DNA repair protein XRCC1

SCOPe Domain Sequences for d3pc6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pc6a1 c.15.1.1 (A:536-631) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elpdffegkhfflygefpgderrrliryvtafngeledymnervqfvitaqewdpnfeea
lmenpslafvrprwiyscnekqkllphqlygvvpqa

SCOPe Domain Coordinates for d3pc6a1:

Click to download the PDB-style file with coordinates for d3pc6a1.
(The format of our PDB-style files is described here.)

Timeline for d3pc6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pc6a2