| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.15.1: BRCT domain [52113] (6 families) ![]() Pfam PF00533 |
| Family c.15.1.1: DNA-repair protein XRCC1 [52114] (2 proteins) |
| Protein automated matches [191251] (1 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [189783] (3 PDB entries) |
| Domain d3pc6a1: 3pc6 A:536-631 [183645] Other proteins in same PDB: d3pc6a2, d3pc6b2 automated match to d1cdza_ |
PDB Entry: 3pc6 (more details), 1.9 Å
SCOPe Domain Sequences for d3pc6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pc6a1 c.15.1.1 (A:536-631) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elpdffegkhfflygefpgderrrliryvtafngeledymnervqfvitaqewdpnfeea
lmenpslafvrprwiyscnekqkllphqlygvvpqa
Timeline for d3pc6a1: