SCOPe 2.05: Domain d3pbva_: 3pbv A:

Lineage for d3pbva_ (3pbv A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (11 species)
   not a true protein

7. Species Methanobacterium thermoautotrophicum [TaxId:187420] [189749] (5 PDB entries)

8. Domain d3pbva_: 3pbv A: [183637]
   automated match to d1dv7a_
   complexed with gol, up6; mutant

Details for d3pbva_

PDB Entry: 3pbv, 1.3 Å

PDB Description: Crystal structure of the mutant I96T of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with 6-azauridine 5'-monophosphate

PDB Compounds: (A:) orotidine 5'-monophosphate decarboxylase

SCOPe Domain Sequences for d3pbva_:

Sequence; same for both SEQRES and ATOM records:

>d3pbva_ c.1.2.3 (A:) automated matches {Methanobacterium thermoautotrophicum [TaxId: 187420]}
vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
iadfkvadipetnekicratfkagadaitvhgfpgadsvraclnvaeemgrevflltems
hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
dpgetlrfadaiivgrsiyladnpaaaaagiiesikdll

Timeline for d3pbva_:

• d3pbva_ first appeared in SCOPe 2.01
  
• d3pbva_ appears in SCOPe 2.04
  
• d3pbva_ appears in SCOPe 2.06
  
• d3pbva_ appears in the current release, SCOPe 2.08