Lineage for d3pbba_ (3pbb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2127146Family c.56.5.8: Glutaminyl-peptide cyclotransferase-like [142532] (1 protein)
    part of Pfam PF04389
  6. 2127147Protein Glutaminyl-peptide cyclotransferase, QPCT [142533] (2 species)
    Glutaminyl cyclase
  7. 2127148Species Human (Homo sapiens) [TaxId:9606] [142534] (22 PDB entries)
    Uniprot Q16769 33-361
  8. 2127175Domain d3pbba_: 3pbb A: [183631]
    automated match to d2afma1
    complexed with pbd, zn

Details for d3pbba_

PDB Entry: 3pbb (more details), 1.95 Å

PDB Description: Crystal structure of human secretory glutaminyl cyclase in complex with PBD150
PDB Compounds: (A:) Glutaminyl-peptide cyclotransferase

SCOPe Domain Sequences for d3pbba_:

Sequence, based on SEQRES records: (download)

>d3pbba_ c.56.5.8 (A:) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]}
asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
vfvgatdsavpcammlelaraldkkllslktvsdskpdlslqliffdgeeaflhwspqds
lygsrhlaakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlq
aiehelhelgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtm
ddneenldestidnlnkilqvfvleylhl

Sequence, based on observed residues (ATOM records): (download)

>d3pbba_ c.56.5.8 (A:) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]}
asawpeeknyhqpailnssalrqiaegtsisemwqndlqpllierypgspgsyaarqhim
qriqrlqadwvleidtflsqtpygyrsfsniistlnptakrhlvlachydskyfshwnnr
vfvgatdsavpcammlelaraldkkllslkpdlslqliffdgeeaflhwspqdslygsrh
laakmastphppgargtsqlhgmdllvlldligapnptfpnffpnsarwferlqaiehel
helgllkdhslegryfqnysyggviqddhipflrrgvpvlhlipspfpevwhtmddneen
ldestidnlnkilqvfvleylhl

SCOPe Domain Coordinates for d3pbba_:

Click to download the PDB-style file with coordinates for d3pbba_.
(The format of our PDB-style files is described here.)

Timeline for d3pbba_: