Lineage for d3pbab_ (3pba B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 923666Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 923667Species Human (Homo sapiens) [TaxId:9606] [48525] (59 PDB entries)
    Uniprot P37231 232-505
  8. 923688Domain d3pbab_: 3pba B: [183630]
    automated match to d1nyxa_
    complexed with pgo, zxg

Details for d3pbab_

PDB Entry: 3pba (more details), 2.3 Å

PDB Description: Crystal structure of PPARgamma ligand binding domain in complex with monosulfate tetrabromo-bisphenol A (MonoTBBPA)
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3pbab_:

Sequence, based on SEQRES records: (download)

>d3pbab_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
sadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkhi
tplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiy
tmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaif
iaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivt
ehvqllqvikktetdmslhpllqeiyk

Sequence, based on observed residues (ATOM records): (download)

>d3pbab_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
sadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmgedkfkhkevair
ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl
isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl
lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte
hpllqeiyk

SCOPe Domain Coordinates for d3pbab_:

Click to download the PDB-style file with coordinates for d3pbab_.
(The format of our PDB-style files is described here.)

Timeline for d3pbab_: